PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g080690.1
Common NameMTR_8g080690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 377aa    MW: 41864.9 Da    PI: 8.8001
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g080690.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.96.9e-39150227178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC  dls+ak+yhr+ +vCe hsk+p+v+++g+ +rfCqqC+rfh+l efDe+krsCr++L++hn+rrrk+q+
  Medtr8g080690.1 150 RCQVEGCGLDLSSAKDYHRKRRVCESHSKSPMVVIDGMVRRFCQQCGRFHNLAEFDEKKRSCREQLSRHNARRRKHQP 227
                      6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-32144212IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.718148225IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.45E-36149230IPR004333Transcription factor, SBP-box
PfamPF031104.1E-31151224IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MDLNAISPSS QWDWEHQSFF NAKATEYPKL QPPSWSIEQD REINVGLFDT PGGSGIFGSA  60
SRSSKSASNS SSLNRNNSKT CIFACGNSHT PELSSVSGEP LLTLLGKRVY IEDVCPKSDS  120
KNLSFSRDLA SSLSIGKKCK FNSQNLQFPR CQVEGCGLDL SSAKDYHRKR RVCESHSKSP  180
MVVIDGMVRR FCQQCGRFHN LAEFDEKKRS CREQLSRHNA RRRKHQPEAL QSSQSVLSSR  240
CDGKQQMSPF ANSKTATNLA WQNMQNSKLP QAKDFLLKPA KDNANTQGTV TMFSDDSIVH  300
FTSKVLATKS IDRGVEDFIT VSDTNDEQDF ICALSLLSTN PWDSYATKSM SLEHSNRPTS  360
AVQAVTHPMS QRMPLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-231512241184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206223KKRSCREQLSRHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446578.10.0squamosa promoter-binding-like protein
TrEMBLA0A072U4360.0A0A072U436_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA18G00903.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.45e-48squamosa promoter-like 11
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]